DPCstruct | MC40921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 146 ± 29 aa |
| Standard deviation of domain lengths | 28.81 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831WPL4 | 12-138 | ASMAVGLEARVPFLDHNLVEFAFSIPANCKIRGITTKYILKKAMSRFLPRKVLKKRKHGFAVPTEPWFRNELKNFAFEIIMDDLTYR… |
| A0A6I7X4U5 | 5-124 | LEVRVPLLDHELVEWMAKLSPDLKLRNREGKYIFKKSLEPYLPNDILYRPKMGFSVPLNSWFKGPLKDQVRESLLGETMAGCGFFDR… |
| A0A2B8I152 | 60-180 | None |
| A0A3D1F7B9 | 2-76 | None |
| A0A3C2ASJ7 | 53-198 | None |
| A0A7X7H2T9 | 42-197 | None |
| A0A661GV58 | 3-115 | None |
| A0A529P396 | 12-153 | None |
| A0A395M3X5 | 3-116 | None |
| A0A7G8GNK7 | 11-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.