DPCstruct | MC40920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 193 ± 26 aa |
| Standard deviation of domain lengths | 26.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831SKQ5 | 16-224 | QLRDRANRLFTYLLELTKLRTKAIRTLQQYEQVLWLKDIPQEPECHCIAWESTENEKQSEVWVEIHKPKLKPPPKAPELLYPWLDPH… |
| A0A1V2Y674 | 5-201 | QEKDKIKSLFRFLKQYNNIKNPTIIDINSQQWHKWIDNIPVHENIKNNIYKQDEDSSVILTVGKPEFTECPKPPSELIEWLENEWDK… |
| A0A439F1E1 | 1-134 | None |
| A0A357VH11 | 2-228 | None |
| A0A7X6VBV9 | 2-199 | None |
| A0A3B9Y8K1 | 4-226 | None |
| X0RC20 | 6-230 | None |
| A0A009PSZ3 | 79-277 | None |
| A0A829ZUZ7 | 13-232 | None |
| A0A2W6ERX6 | 2-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.