DPCstruct | MC4092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 65.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.89 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6P9N5 | 1-102 | MEDAPKTPIGPIHSQNTDLGPQTPPQNQKIGQKSQNTTPDRLKVPKAFKYPERYRSPTDLMVSPISKGLLARTRKPGILLPPTIVQP… |
| A0A835H4D9 | 18-93 | EKTPPSQTLKPDQSPSSLENSSKNGIPDPLKVPIAFKYPERYRSPTDQMVSPVSKGLLARRKKLNSVLPPTKTPSK |
| A0A4D9BU73 | 6-107 | None |
| A0A6P6TK51 | 1-95 | None |
| I1LWS4 | 3-104 | None |
| B9H443 | 43-153 | None |
| A0A1S3Z051 | 16-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.