DPCstruct | MC40918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 11.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.31 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0123- PF08707 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T5BTP4 | 4-69 | LPPQSTIVLNHLRAEGSISQWEAHGVYGIRRLASRIDEIVAAGWDLVKEEKRDAKGQRYIRYDLSP |
| A0A1S9ZHF4 | 1-76 | MTQNQQILDYLMAGNTITPLEALERFGCFSLAARVYELKNTHGKPIQSKLIELPNGKRCAQYWLDRDYIAITSLKD |
| A0A1G4T7K9 | 215-284 | None |
| A0A355IR67 | 3-75 | None |
| A0A2D2E5I3 | 46-120 | None |
| A0A5E8GZ53 | 1-71 | None |
| A0A679IAI6 | 26-124 | None |
| A0A7H4MHR9 | 90-161 | None |
| A0A240U5K7 | 81-165 | None |
| X0SND1 | 36-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.