DPCstruct | MC40911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 279 |
|---|---|
| Mean domain length (aa) | 276 ± 60 aa |
| Standard deviation of domain lengths | 60.30 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.14 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0161- PF00958- CL0288- CL0395- PF02615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E5QW28 | 5-298 | RIIDSHTGGEPTRLVIGGFPDLGQGDMAERRRLLGERHDAWRAACILEPRGSDVLVGALLCAPVDPEACAGVIFFNNSGYLGMCGHG… |
| A0A0N8IBH8 | 9-263 | FTDTPFGGNQLAVVPEAGDLSEAQMQTIAREFNFSETSFVLPPEDPSHTARVRYFTPMRELPFAGHPTVGTAVMLSDLGGANDMVLE… |
| A0A366R256 | 6-358 | None |
| H0ECZ2 | 873-1097 | None |
| A0A1S1MSC4 | 5-201 | None |
| A0A146HIS5 | 225-577 | None |
| A0A146H1C6 | 6-304 | None |
| A0A2H4SWA3 | 175-552 | None |
| A0A662QLQ8 | 5-234 | None |
| A0A812ND66 | 440-702 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.