DPCstruct | MC4091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 62 ± 1 aa |
| Standard deviation of domain lengths | 0.88 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 85.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.98 |
| Mean intra-cluster sequence similarity (%) | 55.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00584 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A501XTY7 | 1-62 | MAKTSPGEFVRQVRQETAKVVWPSRPEVIRTTILVLIMTSILAVFFLGVDQVLGRAVKFFLG |
| V4TP61 | 1-64 | MAKTNPFQFLQQVRAEGAKVTWPSRRETAITTVMVFILSAVASLFFFVADQFFALGVELLLGIG |
| F2J5R8 | 1-63 | None |
| A0A2A5BFZ7 | 1-61 | None |
| E2CNW6 | 1-62 | None |
| A0A166A1Z3 | 1-61 | None |
| A0A0F3IJS9 | 1-62 | None |
| A0A4Y9EQ14 | 1-62 | None |
| A0A4R2PA79 | 1-62 | None |
| A0A1I6ZXA9 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.