DPCstruct | MC40909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 254 ± 59 aa |
| Standard deviation of domain lengths | 59.13 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1S4J0 | 47-297 | MSVPSPGDAPFIDPTQFKATPKPLGFIDTIALIFCVTDFAEKQAREATLNHAEDKWKMMKQRWVREAGDGLFNDGHFTEKLKELEQL… |
| A0A7Y6E538 | 210-419 | HQLTQRLQRTHARIQSDLARDSAAVAHELADLRHARQRAHANTLDTVRAEWIRQRLRQHRIADARLKGVGAVSIGHLEAAGIRTAAD… |
| L3Q470 | 83-363 | None |
| A0A072TPJ3 | 103-434 | None |
| A0A659YTF3 | 1-183 | None |
| A0A1E4X9Y4 | 142-429 | None |
| A0A271KXM4 | 9-283 | None |
| A0A3C0WS03 | 88-254 | None |
| A0A514WSJ2 | 358-633 | None |
| A0A7K4CG83 | 175-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.