DPCstruct | MC40908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 551 ± 91 aa |
| Standard deviation of domain lengths | 90.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.84 |
| Pfam Score | 71.11 |
| Assigned Pfam label(s) | PF15615- PF13208- CL0414 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A5B3Y6 | 610-1232 | GASGPAEVIIGTSTGSRSIPIPPRPVYVEPAAVATEEKSSIELKDLGIRFEITYSIGHSGSADKFIQDAKKTVNRRGAAVAHVPFMS… |
| D1YGT7 | 5-449 | YRYDLAGSVRKEQNFYLQGKLMATYEDNYQKKQSFLRYYPTYHELTVGQAWTYFAWRTKVRNNIYEKVSNSYAYIYLYELLNGIGVE… |
| A0A1R0WEW1 | 6-458 | None |
| A0A4R1L1U0 | 208-898 | None |
| A0A1W1UAI7 | 326-902 | None |
| A0A5C5X9V7 | 47-741 | None |
| A0A4V2AAI5 | 2-558 | None |
| A0A4V1D4E7 | 1-626 | None |
| A0A847PER9 | 2-689 | None |
| A0A843DPZ3 | 127-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.