DPCstruct | MC409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 216 ± 17 aa |
| Standard deviation of domain lengths | 17.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M1AV20 | 1-234 | METSTDYVNHVSIVKELNIYQNAEDSRKNALTFEAVYEKAKKADVKVDTAKDFINSLSRNEQFSIGFSPSDLDSLSNEGAYNLLVHN… |
| A0A2G1CT07 | 6-210 | NYEEHVSIVKKLQYDESFYSVREPFKNDFQKIYNDAKEKGITLSNAKEYLNSLTKEELCTLQNYTRLADEIDVNHLNDEGAYNLLLE… |
| A0A518ALC9 | 113-345 | None |
| A0A2P2E8C9 | 12-221 | None |
| A0A081G4B0 | 1-192 | None |
| A0A6L4B874 | 38-254 | None |
| C6CCB9 | 37-277 | None |
| A0A0U3AZ62 | 7-210 | None |
| A0A1H9HJG8 | 14-254 | None |
| A0A4Q0XTL0 | 9-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.