DPCstruct | MC40892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 96 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.81 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3V613 | 2-99 | AQDVFERVDALVARSAGLPPPHVRARLRQAGRLTQAEVAEALGVHRVQVVRWEGGKAEPRQPHRLLYARLLCGLAEKYPEAACQAGA… |
| A0A6G2V2H8 | 1-81 | MSELFDAVDALVASRSVLPPAQERKRLRVAHGLTMDDVARTLKVRRATVSSWESATKPTEPRGPEREAYAHLLNQLAELYP |
| A0A3N0DA03 | 12-101 | None |
| A0A0F4JEC2 | 1-81 | None |
| A0A525WIU5 | 20-107 | None |
| A0A7K2Y379 | 6-98 | None |
| A0A1C6LH68 | 1-104 | None |
| Q849G7 | 3-77 | None |
| A0A086H4C3 | 1-111 | None |
| A0A101USA4 | 6-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.