DPCstruct | MC40883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 239 ± 27 aa |
| Standard deviation of domain lengths | 26.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5D1J0 | 74-277 | SSVFVREGVTVRSVFVVPAGASEVTLRHVVLDGVSPVLYVPWMARDGVRIVVQDVSLLNGAVLYVMGGGALRGAVSAGSDEGGPVEL… |
| A0A7J6Y0T8 | 28-264 | AVVLRLRGGTVDRAITVGRAVDTVLMDGVYVTNGVAVVFDVAAMLPGALRIELRNCVCDGGAQIYVRGYSGEPASDRSLEVSVTVLS… |
| A0A3R7PH53 | 331-562 | None |
| V5B9F4 | 1-244 | None |
| V5B600 | 100-326 | None |
| V5AL66 | 815-1111 | None |
| Q4CXS6 | 1064-1334 | None |
| K2NV88 | 398-643 | None |
| K2NBT2 | 1-210 | None |
| V5AKB8 | 161-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.