DPCstruct | MC40882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 208 ± 46 aa |
| Standard deviation of domain lengths | 46.30 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5BCW3 | 2-203 | GNTCAPQKGPRFKNFVIAVYSDDPHNGPVREALGKLQNYIASNPERIPRVCRKISKLLTIYLKRQKAHRVMVGVQMLRDLIAHFDDV… |
| A0A453I8P2 | 1-155 | PPNERKIMKLCEYAAKNPLRIPKIAKFLEQRSRKELRAAHLNYVKIITEAYSKLLFICKEQMAYFAISLVNVLTDLLESKQENIHIL… |
| A0A183WSU5 | 26-194 | None |
| A0A3Q3G069 | 19-169 | None |
| A0A177VXW0 | 6-222 | None |
| A0A2B4S862 | 2-229 | None |
| A0A445IMJ6 | 12-251 | None |
| A2XQ50 | 19-232 | None |
| A0A453SPI7 | 6-144 | None |
| T1FS07 | 3-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.