DPCstruct | MC4088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 200 ± 28 aa |
| Standard deviation of domain lengths | 28.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9X0V9 | 601-779 | SIHSENRSKADDKGDDKGDSAEGDAKEPEATPPVARKPYKDPTLWVRGFTGTLLKGAAPGEPARPDDSRSWDCKILWCIECHGPCPI… |
| A0A2I2G8L6 | 1-283 | MQCLKETDQILCTDYMLVDMDLPEPRTAPKAPEPGLLPKMKDAAQQALSKKKSGDVKPSRKYNRSALHIKNLDDKTPEARKNLQELA… |
| W9XTE6 | 231-413 | None |
| A0A5N6TUH9 | 1-196 | None |
| W2RV46 | 641-819 | None |
| A0A165FF31 | 330-509 | None |
| A0A1L9VMS6 | 155-347 | None |
| A0A0D1YNQ4 | 204-387 | None |
| A2R094 | 167-391 | None |
| A0A4S8UX67 | 121-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.