DPCstruct | MC40879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 217 ± 13 aa |
| Standard deviation of domain lengths | 12.50 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 34.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11024 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7PH53 | 161-363 | VYADSFDVKNGGHFDVENNTISAARGIYVYSGLTVSSAGLLRVADCAFVGNAGDSDSSLFYLFDDIVLQGGGQLRVEDNNVRAAAVL… |
| V5AK25 | 5-208 | GYIDMENNTMSAFNGVYVFGCTTVSSAGLLRVADCNFFDSTRVSNSALFYLSGSVTLQSGAQWRVEGNNVSAVSLLAIPYFWHKIRL… |
| V5CV09 | 127-371 | None |
| V5AL66 | 646-855 | None |
| V5AKN0 | 1-212 | None |
| Q4CQI0 | 797-1030 | None |
| K2NV88 | 638-849 | None |
| K2N2Z6 | 352-565 | None |
| K2MU56 | 114-329 | None |
| Q4CR75 | 550-770 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.