DPCstruct | MC40878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 164 ± 23 aa |
| Standard deviation of domain lengths | 23.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0A4L2 | 107-261 | GVIGALAAGGADFLVAKMPIENKAVSTMRTITTVTTVVFKITFSGPGQKYLAKGYLSFMKANDNRKVGAVFNTALVVPALFCTCYHF… |
| A0A5N6XHY6 | 51-208 | GIIAAGSQGASDFLVPKDAIGNKAASTISTITTVAVIAAKIVFSGPAQKRFGAPEGGKFKPLAVGDGRATGAIVNSILVIPALVVSG… |
| A0A5M3YRC5 | 525-681 | None |
| B8NN94 | 620-817 | None |
| A0A1V5MHB1 | 2-117 | None |
| X0LUK2 | 6-180 | None |
| A0A2L2SS86 | 506-660 | None |
| Q2UIM6 | 651-844 | None |
| A0A2P4ZB86 | 365-536 | None |
| A0A318Y6Z5 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.