DPCstruct | MC40876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 70 ± 11 aa |
| Standard deviation of domain lengths | 11.39 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0159- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1SIZ4 | 14-82 | NNIHADPLFFDPTNGDFHLQSTSPCIDVGDNGAWNLPTTDFEGDDRIIDGDGDGTAVVDMGADEYKPQQ |
| A0A800C6I3 | 117-176 | KGPHDIFDAPVFDDPENGDYHLQADSPCIDAGTSHGAPDTDMDGNLRPNGEGYDMGAYEF |
| A0A3A0CFI6 | 167-248 | None |
| A0A7X7TZD3 | 102-161 | None |
| A0A832C7Q3 | 722-789 | None |
| A0A832C8S0 | 337-403 | None |
| A0A7L4ZPV7 | 949-1011 | None |
| A0A359HKP5 | 824-889 | None |
| A0A7X7DIL7 | 988-1050 | None |
| A0A7X8QS21 | 30-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.