DPCstruct | MC40874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 128 ± 20 aa |
| Standard deviation of domain lengths | 20.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.41 |
| Pfam Score | 61.11 |
| Assigned Pfam label(s) | CL0175- PF03243- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0XJC6 | 8-127 | IAYGGEQQKRCPICGMLLKGNENTAFVIEWKNGDETTYCCPHCGLWVVAQGDERILFAKTRDFISGEWVDAKKAFYLFNSKAVPACS… |
| A0A432SK42 | 30-145 | MFCTECGMNLPMFYKTNHAADVDGKVKQYCSIHCLVEDKEKNGKDLKNIRVVDVQTLKFIPVEKATYVVGSSVKGTMSMTSKYAFAD… |
| A0A3A4ZVW4 | 94-223 | None |
| A0A7X2IL31 | 21-142 | None |
| A0A833H3Q6 | 45-191 | None |
| A0A558DAK8 | 17-146 | None |
| U1QMF4 | 34-196 | None |
| A0A7C5N1G7 | 189-323 | None |
| A0A1I6UTC8 | 269-379 | None |
| A0A3M1G3Y5 | 4-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.