DPCstruct | MC40873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 172 ± 21 aa |
| Standard deviation of domain lengths | 21.16 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11452 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G4HWX8 | 4-155 | WSSYPATETFYRLLEWLNGAESVFESNDSAFSGAAANTSKQSSQRLQCSGRLMILYRDLSVNTAPAQIGWLTNAAAHALGRIDPEFE… |
| A0A395KT97 | 56-207 | NYGWIDLRGHPERVGEIPEATKSAGLAKLLRVIAVPVSKVMSGGCECAAFDRGLDFDGPRWLVGGFVDVMFIDAERNVDPQNHVDLA… |
| A0A0F9QQ23 | 22-188 | None |
| A0A1V3KRB8 | 7-181 | None |
| A0A436GQK8 | 32-194 | None |
| A0A2A3ACW3 | 10-204 | None |
| A0A7K3TH86 | 46-227 | None |
| A0A2V8X2M4 | 19-154 | None |
| A0A1C6SNZ2 | 8-196 | None |
| A0A1T4YEM6 | 28-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.