DPCstruct | MC40866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 176 ± 31 aa |
| Standard deviation of domain lengths | 31.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815WCQ5 | 1-183 | NDDGDDIDDQQIQGDSNQIKKFNDPEACEQTHHIVIPSYSAWFDYNAINSIEKRALNEFFNAKNRSKTPEIYMAYRNFMVDTYRLNP… |
| A0A6J1WID0 | 27-137 | FDYNSIHTIEKRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPTEYLTSTACRRNLAGDVCAIMRVHGFLEQWGLVNYQLEAESR… |
| A0A0D9VD98 | 217-337 | None |
| A0A066VNE7 | 509-692 | None |
| A0A7S2XIK0 | 9-158 | None |
| A0A0V0QWN3 | 182-382 | None |
| A0A445C201 | 1-188 | None |
| A0A2I0HN97 | 127-284 | None |
| A0A0D2NUX5 | 402-537 | None |
| A0A1Y1VI93 | 88-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.