DPCstruct | MC4086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 236 ± 33 aa |
| Standard deviation of domain lengths | 33.08 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 24.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428RWD6 | 191-419 | QCRWTNCKESCPKGWVHVGRLDKGARKDELMYDETGCGGDGSHLFCCPPDQDIPQCGWYGHGNGACTKSTSCPSGMAEIGSNQMYCN… |
| A0A2I2FZY8 | 16-282 | ISSAEQLPGSGRAQRPSYLIPDLAANCFIGDTIHPDAPQEAYTPYLTVGYETAQCEGDLCGKPICCPPEIAREIDLHDCTWRGSASD… |
| A0A6A6RN43 | 2-232 | None |
| A0A066XHZ4 | 623-852 | None |
| T5BF82 | 221-406 | None |
| V2X6M9 | 482-753 | None |
| A0A1L9PNC0 | 1-278 | None |
| A0A084R3N4 | 80-276 | None |
| A0A1V6RL48 | 3-217 | None |
| N4V4Y7 | 60-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.