DPCstruct | MC40853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 171 |
|---|---|
| Mean domain length (aa) | 233 ± 36 aa |
| Standard deviation of domain lengths | 35.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.07 |
| Pfam Score | 95.92 |
| Assigned Pfam label(s) | CL0244- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0KZ41 | 4-233 | ESRVRAAAFRITAHFEGSGYASYQNIDSGIVSYGRFQFTLASGMLRQIVDQFVAQSTTLTASQLRAYQGRIVARDASLRRDQTFRDL… |
| A0A7T5END0 | 3-186 | DHFFRWLEGKDKDIYNKLLSGFNADGKKIGAHFDQKFKEIAEQDPDRFLELQHLYTKEKYYDVVDRALKQDLGFDVSKRSAALQDVL… |
| A0A6N2R6B9 | 228-435 | None |
| A0A2V7Y550 | 680-896 | None |
| A0A3N9NWJ9 | 21-288 | None |
| A0A655UNW2 | 115-315 | None |
| A0A1W1X910 | 139-389 | None |
| A0A538PX01 | 314-577 | None |
| A0A416PCI9 | 390-593 | None |
| A0A0H1ASW2 | 209-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.