DPCstruct | MC40847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 180 ± 18 aa |
| Standard deviation of domain lengths | 17.58 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819XL10 | 1-160 | SVTINLGAIRPWPEKNPKKMYTSFFEEYLTSGTPYIKGLYYPMNKRWKGIKKEEIIKLVRRAAQMIMNGFSIPVNPRDNLASDGQLF… |
| A9UPM5 | 596-787 | LEKMGSSDIYITGPGTGMMLSPFMPNMSVVVNLGDCFKRYDRIHPSFEEEYVTEGSDFLRGLYYDSHTRLQGLQKPKLVELFREAFK… |
| A0A7J6RPN3 | 249-442 | None |
| A0A7J6PGI1 | 196-376 | None |
| A0A817QQX5 | 316-472 | None |
| A0A821G2P6 | 73-256 | None |
| A0A813KAN2 | 15-179 | None |
| A9UXW1 | 531-708 | None |
| A0A817N3W9 | 2-199 | None |
| A0A821ZYY6 | 12-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.