DPCstruct | MC40846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 21.24 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819XFV2 | 150-315 | NDSEPIQTSRVVTDEVHLCDQISRLDDDEYDEAPNNDYSQQFVNIGQRPQNYIRDAGLQDRFEEYPKLQELIRLKDEHINKTSPPPM… |
| A0A7M3QRQ1 | 3-148 | KSCIGTQSANPHNDYCQHFVDTGERPQNFIRDTGLKNRFEEYPKLRELIHLKDELIQARATPPMYLRADLLTFDLRELDSVFDVILI… |
| A0A1I8I7C4 | 320-465 | None |
| A0A7J9KMX4 | 754-880 | None |
| T1H1I9 | 1-128 | None |
| A0A0E0QZS2 | 890-1051 | None |
| A0A6A4NHX2 | 247-409 | None |
| S9WQ13 | 33-156 | None |
| A0A6A4WVB6 | 1-149 | None |
| A0A2C6JVJ5 | 31-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.