DPCstruct | MC40845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 194 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Standard deviation of domain lengths | 20.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.09 |
| Pfam Score | 20.00 |
| Assigned Pfam label(s) | CL0031- PF02140- CL0001- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6L627 | 5-101 | EVSWDGWYRLFIQDQSVQMPDTCVDMLSCGTHAPLWLTGGHPTVEDGVVTRDVCGHWDNDCCYFQSNPIKVKACSGNYFVYEFVKPA… |
| A0A819XFK6 | 249-373 | RQPLQEPQPPQARRQHATRNVGYTVAVYGCDTSSVWPTRWYRFSGGAGTMLANYVVAINRCGTQAPGWYTGAYPSTAGSTTSGTVCY… |
| A0A1S3ILV7 | 1-72 | None |
| V4AEE9 | 13-129 | None |
| A0A1S3IU42 | 117-232 | None |
| A0A1S3JFK8 | 16-172 | None |
| A0A3R5YNB0 | 326-475 | None |
| A0A821R9E6 | 86-214 | None |
| A0A5A9PRJ0 | 189-373 | None |
| A0A5A9PU76 | 293-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.