DPCstruct | MC4084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 10.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6SV61 | 1-70 | MQLLPALITALTLCTGVFAQDWHGCAAGFSCQNKEQCRNQRDCQEQAHHNLDKIHCGQANHPVACWAYTN |
| A0A2I2FUH0 | 8-83 | MTVLGLSAIVLAAPAPAEANTQDPGWHGCGNGSACHADADCRSRPECIQMAGGPSHIDRIHCGQANHPVACWTELC |
| A0A2B7ZFF4 | 91-174 | None |
| A0A0J9ELQ5 | 1-75 | None |
| A0A2B7WSF5 | 1-89 | None |
| A6R9H5 | 5-97 | None |
| A0A0G2J995 | 1-80 | None |
| C0P0A6 | 13-79 | None |
| A0A0G2I2M9 | 33-106 | None |
| A0A2B7ZE66 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.