DPCstruct | MC40839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 508 ± 84 aa |
| Standard deviation of domain lengths | 83.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 12.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6H535 | 616-1186 | SNSNSSTSGEGETSSNSTGGSTGGTEEPPGEEPPGEEQETGNNKVSFSVMPLFFGDFNKYTRAINLANSDKDAYEDNSLQRDHGTNG… |
| A0A7G7HRY7 | 53-492 | GDRVKKADLPKGSYSESESRGKVVKLTLSAWVTHADAGVNDKGQSLERATLTGTAELSAGGKVRLGKVGVDAKAFVGTENSYSATAP… |
| A0A7Y4MZ99 | 68-547 | None |
| A0A0K2ZMP6 | 41-454 | None |
| A0A3A8NP11 | 349-779 | None |
| A0A7Y5XWT3 | 46-530 | None |
| A0A496XJF1 | 27-657 | None |
| A0A496XPU7 | 43-642 | None |
| A0A1Y5F4J2 | 243-815 | None |
| A0A2E6H0W6 | 444-1049 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.