DPCstruct | MC40837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 123 ± 27 aa |
| Standard deviation of domain lengths | 27.39 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.07 |
| Pfam Score | 60.83 |
| Assigned Pfam label(s) | CL0110- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9HNC4 | 102-223 | PLDPLVDALATDADPATAFERVDPVSVDYAVLERAADVRVVPAAFDWDDLGAWNALGRLLDGENAVLGDATTIDATGNVLASDDKHV… |
| A0A3L7YJR7 | 211-351 | EEMALHMPKLSAGLEQIGAALGQAHAARTMAKVWPQLPVETIDYGVMEKAARVALLPVEIGWSDVGSWDVVYNLLPHDAHGNAVSGQ… |
| A0A7W0T221 | 101-239 | None |
| A0A257TN74 | 106-238 | None |
| A0A3L7SH69 | 21-132 | None |
| T0E8L8 | 7-113 | None |
| A0A1W9F4C4 | 2-88 | None |
| M9LYX7 | 783-933 | None |
| A0A365VRG2 | 36-180 | None |
| A0A177U7K2 | 171-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.