DPCstruct | MC40831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 321 ± 56 aa |
| Standard deviation of domain lengths | 55.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 65.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.78 |
| Pfam Score | 78.95 |
| Assigned Pfam label(s) | CL0123- PF12253- PF15539 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2X8U2 | 14-277 | RKLYGTMKLLLFHENHRPAYWGTWRKTSLHISPRCPLRKDTDLLDYEVDSDEEWEEEEPGESLSHSEGEDEDEGGEDDDDNDGFFVP… |
| A0A1X2IGP8 | 37-355 | IDHSPEEFDDQLRRRYLQELTTKRQELTFPRRIKRKVDLKQLLLPGTTGSNLDAIHRPENKSLLKMKLLQFTEDVRPAYYGTWTKSS… |
| Q6C0U7 | 142-504 | None |
| A0A0C2I5X3 | 107-385 | None |
| J5RFD0 | 194-588 | None |
| A0A146H6I6 | 342-736 | None |
| A0A3N4IQ31 | 28-344 | None |
| A0A1X0RRQ7 | 3-261 | None |
| A0A310SQY2 | 1-326 | None |
| T1JHB3 | 314-670 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.