DPCstruct | MC40830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 233 ± 28 aa |
| Standard deviation of domain lengths | 28.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2IAX9 | 20-245 | WRWDCNLYDSLITDLLPKVNTPLSNNMVLGLNRYTRNLPGFLQYLLRDYPILLRKKKSDVARVFVAKMRRHLTLTQFAMNAGDVLSQ… |
| A0A5E4C9H2 | 5-219 | DHGMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLSNAMNNIPQRMIQTKVAAVSAFAQTLRRYTSLNHLAQAARAVLQNTSQ… |
| A0A6S7HIU4 | 149-412 | None |
| A0A0B7NG15 | 776-1027 | None |
| A0A836DAS3 | 4-220 | None |
| A0A0M3IUN5 | 35-287 | None |
| A0A067RNG3 | 14-243 | None |
| A0A1D2N8M7 | 827-1087 | None |
| A0A2A4JU32 | 148-359 | None |
| H0XQ11 | 204-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.