DPCstruct | MC4083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 148 ± 24 aa |
| Standard deviation of domain lengths | 23.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I2FTX4 | 1-143 | MSAESAPITPSMFAEAIQELSLSVLYAKVSELRNSVAHLQRSNDELKTFVLESCDSADEKRELESYIAENEGVMTSMTERIALLKAE… |
| A0A6A7C5H7 | 1-100 | MSTAPISLQAFGEAITSLTSGNLFAKAAEIDNSLLHLVQSNEILAQEDDDECRLAVKENEELIKTLKKRLNLLQSEVEKRGLKWTEK… |
| A0A433DFR9 | 37-211 | None |
| Q2HG30 | 1-158 | None |
| A0A0F8WZH8 | 1-146 | None |
| A0A2D3VL03 | 1-121 | None |
| A0A1C7LZ88 | 2-133 | None |
| A0A3N2PYX9 | 4-147 | None |
| A0A4V5N6H7 | 25-170 | None |
| A0A4Z1G104 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.