DPCstruct | MC40828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 134 ± 37 aa |
| Standard deviation of domain lengths | 37.07 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 71.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.43 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | PF04081- CL0475 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2I865 | 9-141 | RQSSIKTRLTRPSRNGAKRGKKVESTNSPLFDDPQKMNKKAKEKHSTIDVNKKDTTNVLNDLAPPRPIEVHQENMKEIDKQLRAFDL… |
| A0A4D9DRG7 | 8-111 | TDSFQVVKRQRRDPDTKEGSLHQEAVPVPDDGPPGGSLHPAQLEMLKQFDLSWEYGPCTGITRLQRWERAESLGLRPPLTVRETLLE… |
| A0A409XW71 | 488-643 | None |
| A0A061EYV8 | 47-152 | None |
| A0A2T0FPA9 | 1-147 | None |
| A0A0D6EJF9 | 1-176 | None |
| A0A2X0LU41 | 2-188 | None |
| A0A7R9UYZ9 | 14-122 | None |
| A0A2T7PD13 | 267-342 | None |
| A0A365MJI6 | 421-580 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.