DPCstruct | MC40827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 177 ± 33 aa |
| Standard deviation of domain lengths | 32.73 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 24.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2I2V2 | 275-421 | KDDIFYKDYPLNFDMLNNKSTITLHHRFHDSQPYHYLQLTPKGYFVARKPYNQRFLPYANLRKEMLCSHFQLDEHSLGIEFVQLNFF… |
| A0A1X2I090 | 50-210 | FSCNFDLIDPSTIMLHLSSDQHHTDTEEEEEEDGKHGSYLTLKPIEYYVDYHFRWTRAHVGDTLCKTQDFYQQFDIVPEDVNDDPRP… |
| A0A1X2I1G2 | 186-330 | None |
| A0A1X2I9M3 | 4-137 | None |
| A0A1X2I2Z5 | 30-190 | None |
| A0A1X2I1K8 | 508-661 | None |
| A0A1X2I095 | 93-247 | None |
| A0A1X2I001 | 1-226 | None |
| A0A1X2HYQ1 | 29-247 | None |
| A0A1X2HY72 | 1-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.