DPCstruct | MC40826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 157 ± 17 aa |
| Standard deviation of domain lengths | 16.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 46.67 |
| Assigned Pfam label(s) | PF08633- PF10278 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2HXD0 | 6-138 | TGGTDLLTYYDLVSCYKKYINQTIDPTLSSFVADLPGKTTVEADGYMLHLLRDPHIEQDSGNSIQPLDSITLKDAYQLKEGPVPGFD… |
| S9X4L1 | 1-138 | MPESPKYHYVGSTQFQPVKPSPHENLTELYGLTELAKKVGRIDEHGNKRKMRRSYKAYIQDLPGQNEIIKDDTLKQWLVNPIMEDVP… |
| A0A1E3NJV0 | 2-151 | None |
| G4VKK2 | 51-203 | None |
| A0A5J4ND20 | 54-202 | None |
| A0A1E3QCG0 | 1-185 | None |
| A0A060T3X3 | 1-193 | None |
| K1WZ79 | 97-258 | None |
| A0A1Y2FIV7 | 1-162 | None |
| A0A1U7LKJ0 | 62-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.