DPCstruct | MC40825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 334 ± 34 aa |
| Standard deviation of domain lengths | 34.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4P520 | 21-314 | KQLLSNELLLTQMEKCALMEALVLISNQFKDYQRQKALLEELMAPVATLWLSDEMKRVLMNPEDFIQYVGADNRIVDPIMEDPCGLN… |
| A0A446NFF1 | 1-385 | MAYLQGEGRLLRAEHDHLCEAFLIMASSSGIQQQQEVLAWLLEPLNKTWTQVEWQTAYLSDPSGLTDMFADTQFMWSIYHTVTFFEK… |
| A0A1D2N4F8 | 533-881 | None |
| A0A821LXM0 | 15-331 | None |
| A0A446NFT4 | 9-387 | None |
| A0A7S0DPZ5 | 5-301 | None |
| A0A287MDC6 | 611-960 | None |
| A0A453NMA3 | 134-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.