DPCstruct | MC40821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 83 ± 16 aa |
| Standard deviation of domain lengths | 16.08 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850QR68 | 132-212 | SDGEYVLTFCTNNLHSITRRAPFGCASLIDEDVTIDFQQETTPNDVVTVIATQPLTNNEQWHKMQPGEFNVFYFGEVVYQA |
| A0A379GF38 | 3-80 | AHCSTNLHYLTRKAPFGKAQRVDDDGIIDFNDYAKEGDLVTIITTFPLTKDETWTKMEYGGFVFFKQGEKIAEIIGVK |
| E3NWC0 | 466-541 | None |
| A0A520KIP3 | 288-394 | None |
| A0A7S1DYN4 | 2-67 | None |
| A0A376YEA9 | 144-222 | None |
| A0A842YBI0 | 98-222 | None |
| A0A7R9P2H0 | 376-446 | None |
| A0A2R4W120 | 69-153 | None |
| A0A7S1CZJ2 | 113-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.