DPCstruct | MC4081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Standard deviation of domain lengths | 12.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7N602 | 3-104 | SGFVVDALLFLAALFIFTVGLGAMAVVILYIIDRTQTSHAIRRNYPVIGRMRYVMEHMGIFLRQYFFAMDREEMPFNRSQRTYVYQA… |
| A0A239JWW7 | 3-128 | SKWLRAIPAVSVAGLVGVAAYDLAQKKHAILRNFPVVGHARYLLEAVGPELRQYIVSGNDEERPFSRNQRRWIYSSAKLRNNYFGFG… |
| A0A2V2AJY3 | 2-89 | None |
| A0A0W0YJG6 | 23-112 | None |
| A0A1H4M5C1 | 43-144 | None |
| A0A6B1HDD5 | 15-110 | None |
| X8FAR6 | 4-104 | None |
| A0A4D4N469 | 33-134 | None |
| A0A1F4AN27 | 1-112 | None |
| N8Q3B9 | 2-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.