DPCstruct | MC40807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 425 ± 63 aa |
| Standard deviation of domain lengths | 63.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401TE96 | 1-303 | MSGGKIFVETLRRIAYPKASQLNGENFDWWFDIGDEKKLIEWFCHSINEQHVLTAEELTELQSLGPKNYLSQKDLDKVLATCPKGAE… |
| A0A5B7F222 | 1-375 | MNGEQLVKHLQALGAPGTEHLVGEAYDWLFVKGKDDPLVTFLQWFMKNITPNNVLTEEELTDFEALKAAGEVLSPTQLQEMEGALSS… |
| A0A0P4WSX4 | 1-450 | None |
| A0A3Q7HY78 | 340-755 | None |
| A0A822ZJG8 | 1-456 | None |
| T1F8F1 | 37-544 | None |
| A0A060WRN9 | 1-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.