DPCstruct | MC40801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 596 ± 63 aa |
| Standard deviation of domain lengths | 62.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564TCT1 | 181-862 | TGKRDPRKKTVGVPFALMIHKFFPMANAFFTSLGFNVVLTDPTSEETIRLAQQTAQGETCYPVKLIYGHMQQLIDQKVDYIFLPTIH… |
| A0A2N9LLB0 | 666-1210 | LPLALTTYELYPLYARFLTGLGFEVVLSRRGLGSRRTAAPLCYPAELMHAAVDDLLAQAVDFVFLPYMREFPAKQSVEHAYLCPITQ… |
| A0A0F0CMW8 | 163-744 | None |
| A0A7V5HZM9 | 49-565 | None |
| A0A1T2KV81 | 1-653 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.