DPCstruct | MC408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 159 ± 22 aa |
| Standard deviation of domain lengths | 21.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A8APE0 | 9-162 | LAAGHAHAAESVYTTLDLDACAVLDQDDESGGISLQCDGLPGHPVFASEGDLRFDVDYGVPNDRWESFGPFNSVNQTVEWRVVDGLP… |
| A0A1F9GN37 | 13-166 | ESIYTDLKGKACKLVWQHEITGDTESECPGVGGNKLIVEDHDVRMSVTVIDPQGEKHRLNYYHTISRGTFSELGSKAEWMVQKKGNQ… |
| A0A6I4TXH0 | 3-115 | None |
| A0A1E3WB28 | 3-136 | None |
| A0A5C7UZX0 | 3-185 | None |
| A0A2S3UY97 | 104-277 | None |
| A0A178I388 | 1-150 | None |
| A0A7W8X8W5 | 14-184 | None |
| A0A5N7MNQ3 | 191-356 | None |
| A0A7W9A243 | 9-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.