DPCstruct | MC40798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 131 ± 23 aa |
| Standard deviation of domain lengths | 22.73 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0AIQ3 | 17-131 | PVPAPVPASSRGDEQLVLSGLHYGQDGRRNGRANMTLDLRPGKRLRVVNQPEWDGQQYHGTCEVVKASQVHAGEGHVALRFTPKAQG… |
| A0A7S0A4K5 | 129-291 | LGTVCINLQQTSEDGSMTLRFFGKSDDVLKELLCELGFGTLKPRAPLWPKVSHALVPYDAEGRRLPDGTRQRMLLDLRDRAKVQITP… |
| A0A7S2EG88 | 125-230 | None |
| A0A7S2DZD2 | 259-383 | None |
| A0A7S2BY94 | 27-142 | None |
| A0A0G4GHS2 | 935-1097 | None |
| A0A7S2I1U4 | 28-177 | None |
| A0A6T8BGH0 | 62-200 | None |
| A0A7S2V081 | 175-283 | None |
| A0A812IWK6 | 714-839 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.