DPCstruct | MC40797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 15 aa |
| Standard deviation of domain lengths | 14.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1PQX0 | 194-319 | AGYGGGDTWNGHRDFTMEDYGPNSMCIETTKPFQVEVAFPEDQRGMLLAMTTVLSQPGKPCNISISVGPHGYWYGGRDGIAELTRAL… |
| A0A7S0AD05 | 1-135 | GMGWSGARDFGHHEYGPHGACVDTLKPFQVTVGFPTDSEGILKAVEVTLKQPGAYCNISMRFDSYEGMPELSEALRAGMTPVVEYWS… |
| A0A7S2K6N3 | 103-249 | None |
| A0A7S2C916 | 74-175 | None |
| A0A1Q9D0I4 | 913-1039 | None |
| A0A7S4HFD1 | 3-100 | None |
| A0A813AWQ0 | 167-293 | None |
| A0A7S0FXK4 | 58-175 | None |
| A0A7S1WKF3 | 1-146 | None |
| A0A7S3H8Q1 | 72-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.