DPCstruct | MC40790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A197F484 | 1-74 | MNLNFNQSLAKNYTSESQKIRVLSEDWVAKQSYCPSCNAEPLVEFANNQPVADFYCAHCSEEYELKSKKAKLSH |
| A0A150NQB7 | 1-85 | MELHFNLELVETYKSNSQKARILTEDWVYRQSYCPNCGNNPLNHFENNRPVADFYCNHCSEEFELKSKKGNFSSTINDGAYATMM |
| X0QWH2 | 1-85 | None |
| A0A3M1M8N0 | 9-86 | None |
| D9QN61 | 10-80 | None |
| A0A1J5J9N0 | 39-123 | None |
| A0A229G8B8 | 1-81 | None |
| Q1PWF9 | 1-74 | None |
| A0A5M8P9F5 | 21-101 | None |
| R9L7V0 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.