DPCstruct | MC4079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 123 ± 13 aa |
| Standard deviation of domain lengths | 12.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2HLP5 | 124-239 | APPLPGSVHDEAAVGAQDEETGRSGSKRVHAKVDYQPQADPHLLVMVTPVLVSVFLSGCAVRLFQLDLQEVMGNDRVVVSRIAKIQT… |
| A0A6F9AZ42 | 100-220 | LDFGGALIQSPYEVWQDPKGPEDPDRPRRRKLVNLSPLSSQEACGDGHLAVVCSEKQAKVILMPTQAVLFTHNITESSFVLQADVVS… |
| A0A182T9D2 | 52-188 | None |
| A0A4U5P9N9 | 175-312 | None |
| A0A158QDD8 | 638-766 | None |
| A0A183D3F4 | 7-145 | None |
| A0A0K2THN2 | 478-590 | None |
| A0A820Y5Z6 | 1-100 | None |
| A0A3P7LTY7 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.