DPCstruct | MC40783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 14.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H1YJL1 | 5-109 | QLSNLLDDLDSAHLADDGLSRLVVTRLAEKRIPYRAMLGKVKLGDKELYPHFWVETSDCVIDYRARPQLNDQRAPHGAVPRERLEAE… |
| A0A0P9ZY92 | 5-119 | LEQHAIRLDALGLDCENLVRVTATLLSANGTSYEAHRGSLWVKGIGHVEPHHWIVLSSGETVDFRARLWLGNEAHIPHGIFTPTHAQ… |
| A0A0H3GWK5 | 66-187 | None |
| A0A368XGE5 | 2-99 | None |
| A0A4U1BSD5 | 1-114 | None |
| A0A076LVW1 | 13-140 | None |
| A0A285TS36 | 177-302 | None |
| A0A7V8F4E8 | 2-103 | None |
| A0A1I2HX18 | 7-124 | None |
| A0A0Q4QRC7 | 68-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.