DPCstruct | MC40782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 157 ± 17 aa |
| Standard deviation of domain lengths | 16.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E1KA67 | 18-164 | HLETDLSLSYQEFDQTMGSGFRALAQAGCERRAADLIEAYIEATGAEQSSLRWHIAQLRASHGDNAEAIRYARASLRENEDLSEHPL… |
| A0A1Q8FLV3 | 4-170 | RYEALELGFQEFDQSEAGWRGVAREGCYLEAANLISNYKQANLDDLGLESTSRLEWHEGQMRAYAGDYSAAINLFRATFDTRESGTA… |
| A0A0F6A8G8 | 20-172 | None |
| A0A422QPG4 | 34-216 | None |
| A0A4T3F188 | 39-212 | None |
| A0A2D6JEY1 | 29-173 | None |
| A0A2J6HLY8 | 14-135 | None |
| A0A0X3UA30 | 3-156 | None |
| A0A177QM62 | 5-154 | None |
| A0A2T4CTZ0 | 20-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.