DPCstruct | MC4078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 238 ± 50 aa |
| Standard deviation of domain lengths | 50.46 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 66.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 22.80 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF00010- PF01056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A336M618 | 6-241 | AKKEEEIDVVSVGDRSTLPTNPSARDRRHLQHKISERMVKTQKNGLRTIPPVRRRCSNDDTPNSSSTNTPVKHFIGGNTTGNPNYAG… |
| Q63379 | 284-460 | RSSSNNKAVTTFTITVRPKTSALGLGRAQPGELILKRCVPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVVPPKAKSLSP… |
| A0A061HZC5 | 1-330 | None |
| A0A1B6EG84 | 323-550 | None |
| F6T9S9 | 378-594 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.