DPCstruct | MC40779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 9.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418CUF8 | 109-184 | KQLCVSLRRHAKHDRVLFHYNGHGVPRPTANGEVWVFNKSYTQYIPLLVYELQVWVGTPSIYVFDCSAAGILLQHF |
| A0A183I889 | 120-192 | RRLCQSLRRNAKEERILFHYNGHGVPRPTENGEVWVFNKNFTQYIPLSIFDLQSWMGHPAVYVWDCHCAGLVV |
| S9U188 | 102-171 | None |
| W2T6I9 | 2-88 | None |
| A2DKJ0 | 2-82 | None |
| A0A6I9PVQ6 | 19-111 | None |
| A0A016TRT1 | 2-67 | None |
| A0A2X0MCA3 | 240-325 | None |
| A0A2G8JU68 | 124-216 | None |
| A0A3S2PIA3 | 229-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.