DPCstruct | MC40778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 148 ± 16 aa |
| Standard deviation of domain lengths | 15.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.51 |
| Pfam Score | 74.54 |
| Assigned Pfam label(s) | PF16350- CL0063- CL0289 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2QW31 | 301-453 | VTHSAGIARAVAELLTTGKSSIDLGDCDIHRFEEVQLTPEYVSETSQQNFVEIYDVLHPLQPKLSPRNLRVSPFHARHKQLGGYFLE… |
| A0A6J1WVA7 | 4-170 | YHVAAGMKTVGISAAGGVAEATVDSIVDGYTKYDMYELDINRFLGLHNNKRFLRDRVKEVPSVHYGLPYPFHEFETGRNLRLSPIYP… |
| A0A212DU43 | 17-166 | None |
| A0A212DUK1 | 78-210 | None |
| A0A1I8IES6 | 55-199 | None |
| A0A5N5TIX1 | 68-224 | None |
| A0A7R9JL90 | 65-194 | None |
| A0A6J0Z3M8 | 522-665 | None |
| A0A7R9FP97 | 116-265 | None |
| A0A1I7WRY2 | 257-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.