DPCstruct | MC40776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 39.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01151 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GK92 | 1-74 | MFYIIKTTIKATVSAYNTYKDPRVEHLPLVGSPFPVFAIVALYLLFSLKWGPRWMQTRKAYDLKNLIAIYNGIQ |
| A0A6J1WRU7 | 2-87 | ATIVRTITSYYHYINDEIADPRTNNFPLVSSPLPILLIMYLYHQFVRKWGPSFMANRQPYNLKSLIIVYNIVQIFLSGYLTVEVCT |
| A0A672KAT6 | 3-72 | None |
| A0A6P7FQV1 | 2-81 | None |
| A0A3Q0IUW0 | 2-83 | None |
| A0A6L5CWS0 | 74-154 | None |
| E9ICJ1 | 4-80 | None |
| A0A0L0C8P5 | 1-86 | None |
| A0A6F9AM64 | 2-84 | None |
| V9ICJ2 | 3-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.