DPCstruct | MC40775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 109 ± 16 aa |
| Standard deviation of domain lengths | 16.33 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 54.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0KL86 | 15-98 | KAMPWFGMDIGGTLTKLVYFEPKDITPDEQDREAGILRNIRRYLTKNSAYGKTGHRDTHLQMDNVEIRKRRGSLHFIRFQTTDM |
| A0A6J1WP94 | 28-155 | CGREGRAAPLPVLTRNKLLKRARHSPYSPPMSNQNSNMAEPAPPTPPDNNTPPMPWFGMDIGGTLTKLVYFEPRETNRRELDKETEV… |
| A0A815CPQ4 | 409-516 | None |
| A0A3Q0IP41 | 23-125 | None |
| A0A6P4E9C0 | 80-180 | None |
| A0A674HXR4 | 2-98 | None |
| A0A2W1BFC0 | 27-159 | None |
| A0A7R9QH93 | 536-668 | None |
| A0A7J7VZZ2 | 10-156 | None |
| A0A4X2L312 | 45-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.